FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3711, 75 aa 1>>>pF1KB3711 75 - 75 aa - 75 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8386+/-0.000266; mu= 9.1569+/- 0.017 mean_var=46.5034+/- 9.338, 0's: 0 Z-trim(119.2): 76 B-trim: 422 in 1/55 Lambda= 0.188075 statistics sampled from 32785 (32861) to 32785 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.786), E-opt: 0.2 (0.385), width: 16 Scan time: 3.740 The best scores are: opt bits E(85289) NP_004476 (OMIM: 604388) guanine nucleotide-bindin ( 75) 489 139.2 6e-34 NP_001092191 (OMIM: 604388) guanine nucleotide-bin ( 75) 489 139.2 6e-34 XP_011542469 (OMIM: 604388) PREDICTED: guanine nuc ( 75) 489 139.2 6e-34 XP_006711824 (OMIM: 604388) PREDICTED: guanine nuc ( 75) 489 139.2 6e-34 NP_001092192 (OMIM: 604388) guanine nucleotide-bin ( 75) 489 139.2 6e-34 NP_001230703 (OMIM: 606981) guanine nucleotide-bin ( 71) 381 109.9 3.8e-25 XP_016876866 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 381 109.9 3.8e-25 NP_001230702 (OMIM: 606981) guanine nucleotide-bin ( 71) 381 109.9 3.8e-25 XP_016876865 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 381 109.9 3.8e-25 XP_011535148 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 381 109.9 3.8e-25 XP_006720236 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 381 109.9 3.8e-25 NP_444292 (OMIM: 606981) guanine nucleotide-bindin ( 71) 381 109.9 3.8e-25 XP_006718563 (OMIM: 608941) PREDICTED: guanine nuc ( 75) 341 99.0 7.4e-22 NP_036334 (OMIM: 608941) guanine nucleotide-bindin ( 75) 341 99.0 7.4e-22 XP_016882095 (OMIM: 604430) PREDICTED: guanine nuc ( 68) 283 83.3 3.7e-17 NP_443079 (OMIM: 604430) guanine nucleotide-bindin ( 68) 283 83.3 3.7e-17 XP_016857300 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 280 82.5 6.8e-17 XP_016857298 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 280 82.5 6.8e-17 NP_061329 (OMIM: 615405) guanine nucleotide-bindin ( 72) 280 82.5 6.8e-17 XP_016857299 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 280 82.5 6.8e-17 NP_005265 (OMIM: 600874) guanine nucleotide-bindin ( 68) 211 63.8 2.8e-11 NP_001185593 (OMIM: 604389) guanine nucleotide-bin ( 68) 204 61.9 1e-10 NP_001017998 (OMIM: 604389) guanine nucleotide-bin ( 68) 204 61.9 1e-10 NP_068774 (OMIM: 189970) guanine nucleotide-bindin ( 74) 142 45.0 1.3e-05 NP_001316355 (OMIM: 189970) guanine nucleotide-bin ( 74) 142 45.0 1.3e-05 NP_001185685 (OMIM: 139391) guanine nucleotide-bin ( 69) 138 43.9 2.6e-05 NP_001185683 (OMIM: 139391) guanine nucleotide-bin ( 69) 138 43.9 2.6e-05 NP_113686 (OMIM: 139391) guanine nucleotide-bindin ( 69) 138 43.9 2.6e-05 NP_001185684 (OMIM: 139391) guanine nucleotide-bin ( 69) 138 43.9 2.6e-05 NP_004117 (OMIM: 604390) guanine nucleotide-bindin ( 73) 136 43.4 4e-05 NP_057625 (OMIM: 607298) guanine nucleotide-bindin ( 67) 116 38.0 0.0016 >>NP_004476 (OMIM: 604388) guanine nucleotide-binding pr (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 730.5 bits: 139.2 E(85289): 6e-34 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA 10 20 30 40 50 60 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::::: NP_004 SENPFREKKFFCTIL 70 >>NP_001092191 (OMIM: 604388) guanine nucleotide-binding (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 730.5 bits: 139.2 E(85289): 6e-34 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA 10 20 30 40 50 60 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::::: NP_001 SENPFREKKFFCTIL 70 >>XP_011542469 (OMIM: 604388) PREDICTED: guanine nucleot (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 730.5 bits: 139.2 E(85289): 6e-34 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA 10 20 30 40 50 60 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::::: XP_011 SENPFREKKFFCTIL 70 >>XP_006711824 (OMIM: 604388) PREDICTED: guanine nucleot (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 730.5 bits: 139.2 E(85289): 6e-34 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_006 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA 10 20 30 40 50 60 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::::: XP_006 SENPFREKKFFCTIL 70 >>NP_001092192 (OMIM: 604388) guanine nucleotide-binding (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 730.5 bits: 139.2 E(85289): 6e-34 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA 10 20 30 40 50 60 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::::: NP_001 SENPFREKKFFCTIL 70 >>NP_001230703 (OMIM: 606981) guanine nucleotide-binding (71 aa) initn: 381 init1: 381 opt: 381 Z-score: 572.5 bits: 109.9 E(85289): 3.8e-25 Smith-Waterman score: 381; 77.5% identity (95.8% similar) in 71 aa overlap (5-75:1-71) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :..:.:.::.:::: :::::::: .::.:::.:::::.::::::..::::. :::: NP_001 MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA 10 20 30 40 50 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::.:: NP_001 SENPFREKKFFCAIL 60 70 >>XP_016876866 (OMIM: 606981) PREDICTED: guanine nucleot (71 aa) initn: 381 init1: 381 opt: 381 Z-score: 572.5 bits: 109.9 E(85289): 3.8e-25 Smith-Waterman score: 381; 77.5% identity (95.8% similar) in 71 aa overlap (5-75:1-71) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :..:.:.::.:::: :::::::: .::.:::.:::::.::::::..::::. :::: XP_016 MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA 10 20 30 40 50 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::.:: XP_016 SENPFREKKFFCAIL 60 70 >>NP_001230702 (OMIM: 606981) guanine nucleotide-binding (71 aa) initn: 381 init1: 381 opt: 381 Z-score: 572.5 bits: 109.9 E(85289): 3.8e-25 Smith-Waterman score: 381; 77.5% identity (95.8% similar) in 71 aa overlap (5-75:1-71) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :..:.:.::.:::: :::::::: .::.:::.:::::.::::::..::::. :::: NP_001 MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA 10 20 30 40 50 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::.:: NP_001 SENPFREKKFFCAIL 60 70 >>XP_016876865 (OMIM: 606981) PREDICTED: guanine nucleot (71 aa) initn: 381 init1: 381 opt: 381 Z-score: 572.5 bits: 109.9 E(85289): 3.8e-25 Smith-Waterman score: 381; 77.5% identity (95.8% similar) in 71 aa overlap (5-75:1-71) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :..:.:.::.:::: :::::::: .::.:::.:::::.::::::..::::. :::: XP_016 MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA 10 20 30 40 50 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::.:: XP_016 SENPFREKKFFCAIL 60 70 >>XP_011535148 (OMIM: 606981) PREDICTED: guanine nucleot (71 aa) initn: 381 init1: 381 opt: 381 Z-score: 572.5 bits: 109.9 E(85289): 3.8e-25 Smith-Waterman score: 381; 77.5% identity (95.8% similar) in 71 aa overlap (5-75:1-71) 10 20 30 40 50 60 pF1KB3 MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA :..:.:.::.:::: :::::::: .::.:::.:::::.::::::..::::. :::: XP_011 MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA 10 20 30 40 50 70 pF1KB3 SENPFREKKFFCTIL ::::::::::::.:: XP_011 SENPFREKKFFCAIL 60 70 75 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 02:38:07 2016 done: Fri Nov 4 02:38:08 2016 Total Scan time: 3.740 Total Display time: 0.010 Function used was FASTA [36.3.4 Apr, 2011]