FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3848, 134 aa 1>>>pF1KB3848 134 - 134 aa - 134 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 8.1430+/-0.000737; mu= 0.2819+/- 0.045 mean_var=202.1347+/-39.925, 0's: 0 Z-trim(116.3): 9 B-trim: 30 in 1/54 Lambda= 0.090210 statistics sampled from 16938 (16943) to 16938 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.83), E-opt: 0.2 (0.52), width: 16 Scan time: 1.790 The best scores are: opt bits E(32554) CCDS4396.1 CPLX2 gene_id:10814|Hs108|chr5 ( 134) 880 125.2 1.2e-29 CCDS46995.1 CPLX1 gene_id:10815|Hs108|chr4 ( 134) 744 107.5 2.5e-24 >>CCDS4396.1 CPLX2 gene_id:10814|Hs108|chr5 (134 aa) initn: 880 init1: 880 opt: 880 Z-score: 645.8 bits: 125.2 E(32554): 1.2e-29 Smith-Waterman score: 880; 100.0% identity (100.0% similar) in 134 aa overlap (1-134:1-134) 10 20 30 40 50 60 pF1KB3 MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS43 MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB3 KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS43 KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV 70 80 90 100 110 120 130 pF1KB3 LKYLPGPLQDMFKK :::::::::::::: CCDS43 LKYLPGPLQDMFKK 130 >>CCDS46995.1 CPLX1 gene_id:10815|Hs108|chr4 (134 aa) initn: 744 init1: 744 opt: 744 Z-score: 550.1 bits: 107.5 E(32554): 2.5e-24 Smith-Waterman score: 744; 84.3% identity (92.5% similar) in 134 aa overlap (1-134:1-134) 10 20 30 40 50 60 pF1KB3 MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE :.::::::::::::::::::::.::::::: :::::::::::: :::::::.:.:::::: CCDS46 MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB3 KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV ::: ::::::.:::::.::: .::.: :::::::::::: ::::: :::.::::::: CCDS46 AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTV 70 80 90 100 110 120 130 pF1KB3 LKYLPGPLQDMFKK .::::::::::.:: CCDS46 IKYLPGPLQDMLKK 130 134 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 05:25:14 2016 done: Sat Nov 5 05:25:15 2016 Total Scan time: 1.790 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]