FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB4553, 145 aa 1>>>pF1KB4553 145 - 145 aa - 145 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0568+/-0.000669; mu= 12.7625+/- 0.040 mean_var=56.4016+/-11.075, 0's: 0 Z-trim(109.0): 14 B-trim: 8 in 1/50 Lambda= 0.170777 statistics sampled from 10548 (10558) to 10548 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.726), E-opt: 0.2 (0.324), width: 16 Scan time: 1.540 The best scores are: opt bits E(32554) CCDS34460.1 MRPL14 gene_id:64928|Hs108|chr6 ( 145) 981 249.2 6.7e-67 >>CCDS34460.1 MRPL14 gene_id:64928|Hs108|chr6 (145 aa) initn: 981 init1: 981 opt: 981 Z-score: 1314.5 bits: 249.2 E(32554): 6.7e-67 Smith-Waterman score: 981; 100.0% identity (100.0% similar) in 145 aa overlap (1-145:1-145) 10 20 30 40 50 60 pF1KB4 MAFFTGLWGPFTCVSRVLSHHCFSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS34 MAFFTGLWGPFTCVSRVLSHHCFSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB4 YKKNGVGKVGDQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS34 YKKNGVGKVGDQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIK 70 80 90 100 110 120 130 140 pF1KB4 TPIPTSLRKREGEYSKVLAIAQNFV ::::::::::::::::::::::::: CCDS34 TPIPTSLRKREGEYSKVLAIAQNFV 130 140 145 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 05:54:39 2016 done: Sat Nov 5 05:54:39 2016 Total Scan time: 1.540 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]