FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB4753, 108 aa
  1>>>pF1KB4753 108 - 108 aa - 108 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3333+/-0.000565; mu= 10.0669+/- 0.034
 mean_var=68.1917+/-13.982, 0's: 0 Z-trim(113.4): 11  B-trim: 792 in 1/52
 Lambda= 0.155313
 statistics sampled from 14072 (14083) to 14072 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.798), E-opt: 0.2 (0.433), width:  16
 Scan time:  1.550

The best scores are:                                      opt bits E(32554)
CCDS10395.1 POLR3K gene_id:51728|Hs108|chr16       ( 108)  805 188.1 9.2e-49


>>CCDS10395.1 POLR3K gene_id:51728|Hs108|chr16            (108 aa)
 initn: 805 init1: 805 opt: 805  Z-score: 988.9  bits: 188.1 E(32554): 9.2e-49
Smith-Waterman score: 805; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108)

               10        20        30        40        50        60
pF1KB4 MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
               10        20        30        40        50        60

               70        80        90       100        
pF1KB4 NVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
       ::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 NVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
               70        80        90       100        




108 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 21:49:28 2016 done: Sat Nov  5 21:49:28 2016
 Total Scan time:  1.550 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]