FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6498, 61 aa 1>>>pF1KB6498 61 - 61 aa - 61 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9977+/-0.000308; mu= 4.5128+/- 0.019 mean_var=147.0561+/-28.521, 0's: 0 Z-trim(122.3): 28 B-trim: 258 in 2/52 Lambda= 0.105763 statistics sampled from 40221 (40264) to 40221 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.782), E-opt: 0.2 (0.472), width: 16 Scan time: 2.420 The best scores are: opt bits E(85289) NP_005944 (OMIM: 156360) metallothionein-2 [Homo s ( 61) 514 87.8 1.2e-18 NP_783316 (OMIM: 156351) metallothionein-1E [Homo ( 61) 493 84.6 1.1e-17 NP_005941 (OMIM: 156353) metallothionein-1G isofor ( 61) 488 83.8 1.9e-17 NP_005940 (OMIM: 156352) metallothionein-1F isofor ( 61) 486 83.5 2.3e-17 NP_005942 (OMIM: 156354) metallothionein-1H [Homo ( 61) 479 82.4 4.9e-17 NP_005937 (OMIM: 156350) metallothionein-1A [Homo ( 61) 477 82.1 6.1e-17 NP_001288196 (OMIM: 156353) metallothionein-1G iso ( 62) 476 82.0 6.8e-17 NP_005943 (OMIM: 156359) metallothionein-1X [Homo ( 61) 473 81.5 9.3e-17 NP_005938 (OMIM: 156349) metallothionein-1B [Homo ( 61) 467 80.6 1.8e-16 NP_789846 (OMIM: 156357) metallothionein-1M [Homo ( 61) 450 78.0 1.1e-15 NP_116324 (OMIM: 606206) metallothionein-4 [Homo s ( 62) 375 66.6 3e-12 NP_005945 (OMIM: 139255) metallothionein-3 [Homo s ( 68) 368 65.5 6.6e-12 NP_001288201 (OMIM: 156352) metallothionein-1F iso ( 44) 260 48.8 4.6e-07 XP_005256013 (OMIM: 156351) PREDICTED: metallothio ( 127) 255 48.6 1.5e-06 NP_005544 (OMIM: 148021) keratin-associated protei ( 169) 176 36.7 0.0078 >>NP_005944 (OMIM: 156360) metallothionein-2 [Homo sapie (61 aa) initn: 514 init1: 514 opt: 514 Z-score: 455.7 bits: 87.8 E(85289): 1.2e-18 Smith-Waterman score: 514; 100.0% identity (100.0% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_005 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_783316 (OMIM: 156351) metallothionein-1E [Homo sapi (61 aa) initn: 493 init1: 493 opt: 493 Z-score: 438.3 bits: 84.6 E(85289): 1.1e-17 Smith-Waterman score: 493; 93.4% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC ::::::::.: :::::::::::::::::::::::::::::::::::::.:::::.::::: NP_783 MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_783 A >>NP_005941 (OMIM: 156353) metallothionein-1G isoform 1 (61 aa) initn: 488 init1: 488 opt: 488 Z-score: 434.2 bits: 83.8 E(85289): 1.9e-17 Smith-Waterman score: 488; 95.1% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::::: :::::.:::::::::::::::::::::::::::::::::::::.::::: NP_005 MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_005940 (OMIM: 156352) metallothionein-1F isoform 1 (61 aa) initn: 486 init1: 486 opt: 486 Z-score: 432.6 bits: 83.5 E(85289): 2.3e-17 Smith-Waterman score: 486; 93.3% identity (98.3% similar) in 60 aa overlap (1-60:1-60) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::::: ::::::::::::::::::::::::::::::.::::::.:::::.::::: NP_005 MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KB6 A NP_005 D >>NP_005942 (OMIM: 156354) metallothionein-1H [Homo sapi (61 aa) initn: 479 init1: 479 opt: 479 Z-score: 426.8 bits: 82.4 E(85289): 4.9e-17 Smith-Waterman score: 479; 90.2% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC ::::::: :: ::.::::::::.:::::::::::::::.:::::::::::::::.::::: NP_005 MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_005937 (OMIM: 156350) metallothionein-1A [Homo sapi (61 aa) initn: 477 init1: 477 opt: 477 Z-score: 425.1 bits: 82.1 E(85289): 6.1e-17 Smith-Waterman score: 477; 90.2% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC ::::::::.: ::::.::::::::::::::::::::::..::::::::::::::.::::: NP_005 MDPNCSCATGGSCTCTGSCKCKECKCTSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_001288196 (OMIM: 156353) metallothionein-1G isoform (62 aa) initn: 425 init1: 425 opt: 476 Z-score: 424.2 bits: 82.0 E(85289): 6.8e-17 Smith-Waterman score: 476; 93.5% identity (96.8% similar) in 62 aa overlap (1-61:1-62) 10 20 30 40 50 pF1KB6 MDPNCSCAA-GDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC ::::::::: : :::::.:::::::::::::::::::::::::::::::::::::.:::: NP_001 MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC 10 20 30 40 50 60 60 pF1KB6 CA :: NP_001 CA >>NP_005943 (OMIM: 156359) metallothionein-1X [Homo sapi (61 aa) initn: 473 init1: 473 opt: 473 Z-score: 421.8 bits: 81.5 E(85289): 9.3e-17 Smith-Waterman score: 473; 90.2% identity (95.1% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::. ::.::::::::::::::::::::::::::::::::::::::.::::::: NP_005 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_005938 (OMIM: 156349) metallothionein-1B [Homo sapi (61 aa) initn: 467 init1: 467 opt: 467 Z-score: 416.9 bits: 80.6 E(85289): 1.8e-16 Smith-Waterman score: 467; 85.2% identity (95.1% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::..: ::.::::::::::::::::: ::::::::::::::::.:::.:.:: :: NP_005 MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCC 10 20 30 40 50 60 pF1KB6 A : NP_005 A >>NP_789846 (OMIM: 156357) metallothionein-1M [Homo sapi (61 aa) initn: 450 init1: 450 opt: 450 Z-score: 402.9 bits: 78.0 E(85289): 1.1e-15 Smith-Waterman score: 450; 82.0% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KB6 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC :::::::..: ::.:.:::::::::::::::::::::::::::::.::.:::. ..:::: NP_789 MDPNCSCTTGVSCACTGSCKCKECKCTSCKKSCCSCCPVGCAKCAHGCVCKGTLENCSCC 10 20 30 40 50 60 pF1KB6 A : NP_789 A 61 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 01:00:11 2016 done: Sat Nov 5 01:00:12 2016 Total Scan time: 2.420 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]