FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6703, 73 aa 1>>>pF1KB6703 73 - 73 aa - 73 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.6785+/-0.000659; mu= 9.2767+/- 0.040 mean_var=43.8856+/- 8.744, 0's: 0 Z-trim(107.6): 19 B-trim: 0 in 0/49 Lambda= 0.193604 statistics sampled from 9684 (9687) to 9684 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.708), E-opt: 0.2 (0.298), width: 16 Scan time: 1.120 The best scores are: opt bits E(32554) CCDS12219.1 UBL5 gene_id:59286|Hs108|chr19 ( 73) 496 145.3 3.2e-36 >>CCDS12219.1 UBL5 gene_id:59286|Hs108|chr19 (73 aa) initn: 496 init1: 496 opt: 496 Z-score: 763.9 bits: 145.3 E(32554): 3.2e-36 Smith-Waterman score: 496; 100.0% identity (100.0% similar) in 73 aa overlap (1-73:1-73) 10 20 30 40 50 60 pF1KB6 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY 10 20 30 40 50 60 70 pF1KB6 EIHDGMNLELYYQ ::::::::::::: CCDS12 EIHDGMNLELYYQ 70 73 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 18:14:58 2016 done: Sat Nov 5 18:14:58 2016 Total Scan time: 1.120 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]