FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6707, 79 aa 1>>>pF1KB6707 79 - 79 aa - 79 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3885+/-0.000496; mu= 12.6143+/- 0.030 mean_var=49.7337+/- 9.829, 0's: 0 Z-trim(113.7): 5 B-trim: 0 in 0/51 Lambda= 0.181865 statistics sampled from 14351 (14353) to 14351 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.822), E-opt: 0.2 (0.441), width: 16 Scan time: 1.300 The best scores are: opt bits E(32554) CCDS6682.1 CKS2 gene_id:1164|Hs108|chr9 ( 79) 565 154.5 6.2e-39 CCDS1077.1 CKS1B gene_id:1163|Hs108|chr1 ( 79) 466 128.5 4.1e-31 >>CCDS6682.1 CKS2 gene_id:1164|Hs108|chr9 (79 aa) initn: 565 init1: 565 opt: 565 Z-score: 812.5 bits: 154.5 E(32554): 6.2e-39 Smith-Waterman score: 565; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS66 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKDQQK ::::::::::::::::::: CCDS66 EPEPHILLFRRPLPKDQQK 70 >>CCDS1077.1 CKS1B gene_id:1163|Hs108|chr1 (79 aa) initn: 486 init1: 458 opt: 466 Z-score: 672.1 bits: 128.5 E(32554): 4.1e-31 Smith-Waterman score: 466; 81.0% identity (91.1% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH :.:::::::::: ::..::::::::....: ::::::::: ::: :::::: :::::::: CCDS10 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKDQQK ::::::::::::::: .: CCDS10 EPEPHILLFRRPLPKKPKK 70 79 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 18:15:30 2016 done: Sat Nov 5 18:15:31 2016 Total Scan time: 1.300 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]