FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6707, 79 aa 1>>>pF1KB6707 79 - 79 aa - 79 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.2763+/-0.000253; mu= 13.2473+/- 0.016 mean_var=50.4173+/-10.152, 0's: 0 Z-trim(120.8): 3 B-trim: 0 in 0/53 Lambda= 0.180628 statistics sampled from 36556 (36560) to 36556 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.812), E-opt: 0.2 (0.429), width: 16 Scan time: 3.970 The best scores are: opt bits E(85289) NP_001818 (OMIM: 116901) cyclin-dependent kinases ( 79) 565 153.6 3.1e-38 NP_001817 (OMIM: 116900) cyclin-dependent kinases ( 79) 466 127.8 1.8e-30 >>NP_001818 (OMIM: 116901) cyclin-dependent kinases regu (79 aa) initn: 565 init1: 565 opt: 565 Z-score: 807.3 bits: 153.6 E(85289): 3.1e-38 Smith-Waterman score: 565; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKDQQK ::::::::::::::::::: NP_001 EPEPHILLFRRPLPKDQQK 70 >>NP_001817 (OMIM: 116900) cyclin-dependent kinases regu (79 aa) initn: 486 init1: 458 opt: 466 Z-score: 667.9 bits: 127.8 E(85289): 1.8e-30 Smith-Waterman score: 466; 81.0% identity (91.1% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH :.:::::::::: ::..::::::::....: ::::::::: ::: :::::: :::::::: NP_001 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKDQQK ::::::::::::::: .: NP_001 EPEPHILLFRRPLPKKPKK 70 79 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 18:15:31 2016 done: Sat Nov 5 18:15:32 2016 Total Scan time: 3.970 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]