FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6708, 129 aa 1>>>pF1KB6708 129 - 129 aa - 129 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6608+/-0.000555; mu= 10.1335+/- 0.033 mean_var=76.1827+/-15.566, 0's: 0 Z-trim(114.1): 1 B-trim: 0 in 0/55 Lambda= 0.146942 statistics sampled from 14671 (14672) to 14671 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.8), E-opt: 0.2 (0.451), width: 16 Scan time: 1.600 The best scores are: opt bits E(32554) CCDS2032.1 COX5B gene_id:1329|Hs108|chr2 ( 129) 875 193.5 3e-50 >>CCDS2032.1 COX5B gene_id:1329|Hs108|chr2 (129 aa) initn: 875 init1: 875 opt: 875 Z-score: 1015.6 bits: 193.5 E(32554): 3e-50 Smith-Waterman score: 875; 100.0% identity (100.0% similar) in 129 aa overlap (1-129:1-129) 10 20 30 40 50 60 pF1KB6 MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS20 MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS20 PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY 70 80 90 100 110 120 pF1KB6 KLVPQQLAH ::::::::: CCDS20 KLVPQQLAH 129 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:29:30 2016 done: Fri Nov 4 23:29:31 2016 Total Scan time: 1.600 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]