FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6709, 79 aa 1>>>pF1KB6709 79 - 79 aa - 79 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7176+/-0.000592; mu= 10.3451+/- 0.035 mean_var=54.0786+/-10.774, 0's: 0 Z-trim(111.9): 51 B-trim: 425 in 2/48 Lambda= 0.174406 statistics sampled from 12674 (12726) to 12674 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.787), E-opt: 0.2 (0.391), width: 16 Scan time: 1.390 The best scores are: opt bits E(32554) CCDS4286.1 SPINK1 gene_id:6690|Hs108|chr5 ( 79) 539 142.6 2.4e-35 >>CCDS4286.1 SPINK1 gene_id:6690|Hs108|chr5 (79 aa) initn: 539 init1: 539 opt: 539 Z-score: 748.2 bits: 142.6 E(32554): 2.4e-35 Smith-Waterman score: 539; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL 10 20 30 40 50 60 70 pF1KB6 CFENRKRQTSILIQKSGPC ::::::::::::::::::: CCDS42 CFENRKRQTSILIQKSGPC 70 79 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:30:03 2016 done: Fri Nov 4 23:30:03 2016 Total Scan time: 1.390 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]