FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6710, 130 aa 1>>>pF1KB6710 130 - 130 aa - 130 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0626+/-0.000702; mu= 10.8274+/- 0.042 mean_var=45.7179+/- 9.188, 0's: 0 Z-trim(106.2): 23 B-trim: 0 in 0/51 Lambda= 0.189684 statistics sampled from 8832 (8839) to 8832 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.674), E-opt: 0.2 (0.272), width: 16 Scan time: 1.420 The best scores are: opt bits E(32554) CCDS10571.1 RPS15A gene_id:6210|Hs108|chr16 ( 130) 860 242.4 5.9e-65 >>CCDS10571.1 RPS15A gene_id:6210|Hs108|chr16 (130 aa) initn: 860 init1: 860 opt: 860 Z-score: 1279.6 bits: 242.4 E(32554): 5.9e-65 Smith-Waterman score: 860; 100.0% identity (100.0% similar) in 130 aa overlap (1-130:1-130) 10 20 30 40 50 60 pF1KB6 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 IVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 IVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH 70 80 90 100 110 120 130 pF1KB6 TGGKILGFFF :::::::::: CCDS10 TGGKILGFFF 130 130 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 18:59:09 2016 done: Sat Nov 5 18:59:10 2016 Total Scan time: 1.420 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]