FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6719, 84 aa 1>>>pF1KB6719 84 - 84 aa - 84 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4609+/-0.000439; mu= 13.5825+/- 0.027 mean_var=57.4729+/-11.393, 0's: 0 Z-trim(116.5): 3 B-trim: 0 in 0/52 Lambda= 0.169178 statistics sampled from 17154 (17156) to 17154 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.871), E-opt: 0.2 (0.527), width: 16 Scan time: 1.490 The best scores are: opt bits E(32554) CCDS1059.1 RPS27 gene_id:6232|Hs108|chr1 ( 84) 592 150.9 8.7e-38 CCDS42048.1 RPS27L gene_id:51065|Hs108|chr15 ( 84) 571 145.8 3e-36 >>CCDS1059.1 RPS27 gene_id:6232|Hs108|chr1 (84 aa) initn: 592 init1: 592 opt: 592 Z-score: 791.9 bits: 150.9 E(32554): 8.7e-38 Smith-Waterman score: 592; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KB6 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS 10 20 30 40 50 60 70 80 pF1KB6 TVLCQPTGGKARLTEGCSFRRKQH :::::::::::::::::::::::: CCDS10 TVLCQPTGGKARLTEGCSFRRKQH 70 80 >>CCDS42048.1 RPS27L gene_id:51065|Hs108|chr15 (84 aa) initn: 571 init1: 571 opt: 571 Z-score: 764.2 bits: 145.8 E(32554): 3e-36 Smith-Waterman score: 571; 96.4% identity (98.8% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KB6 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS ::::.:::::: ::::.::::::::::::::::::::::::::::::::::::::::::: CCDS42 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS 10 20 30 40 50 60 70 80 pF1KB6 TVLCQPTGGKARLTEGCSFRRKQH :::::::::::::::::::::::: CCDS42 TVLCQPTGGKARLTEGCSFRRKQH 70 80 84 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:33:04 2016 done: Fri Nov 4 23:33:04 2016 Total Scan time: 1.490 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]