FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6719, 84 aa 1>>>pF1KB6719 84 - 84 aa - 84 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5345+/-0.000222; mu= 13.1483+/- 0.014 mean_var=58.3499+/-11.730, 0's: 0 Z-trim(123.6): 2 B-trim: 0 in 0/55 Lambda= 0.167901 statistics sampled from 43654 (43657) to 43654 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.867), E-opt: 0.2 (0.512), width: 16 Scan time: 4.340 The best scores are: opt bits E(85289) NP_001021 (OMIM: 603702) 40S ribosomal protein S27 ( 84) 592 149.9 4.4e-37 NP_057004 (OMIM: 612055) 40S ribosomal protein S27 ( 84) 571 144.8 1.5e-35 >>NP_001021 (OMIM: 603702) 40S ribosomal protein S27 [Ho (84 aa) initn: 592 init1: 592 opt: 592 Z-score: 786.7 bits: 149.9 E(85289): 4.4e-37 Smith-Waterman score: 592; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KB6 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS 10 20 30 40 50 60 70 80 pF1KB6 TVLCQPTGGKARLTEGCSFRRKQH :::::::::::::::::::::::: NP_001 TVLCQPTGGKARLTEGCSFRRKQH 70 80 >>NP_057004 (OMIM: 612055) 40S ribosomal protein S27-lik (84 aa) initn: 571 init1: 571 opt: 571 Z-score: 759.2 bits: 144.8 E(85289): 1.5e-35 Smith-Waterman score: 571; 96.4% identity (98.8% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KB6 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS ::::.:::::: ::::.::::::::::::::::::::::::::::::::::::::::::: NP_057 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS 10 20 30 40 50 60 70 80 pF1KB6 TVLCQPTGGKARLTEGCSFRRKQH :::::::::::::::::::::::: NP_057 TVLCQPTGGKARLTEGCSFRRKQH 70 80 84 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:33:04 2016 done: Fri Nov 4 23:33:05 2016 Total Scan time: 4.340 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]