FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6722, 134 aa 1>>>pF1KB6722 134 - 134 aa - 134 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3775+/-0.000577; mu= 12.4098+/- 0.035 mean_var=86.4119+/-17.151, 0's: 0 Z-trim(114.6): 40 B-trim: 130 in 1/49 Lambda= 0.137971 statistics sampled from 15159 (15200) to 15159 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.467), width: 16 Scan time: 1.530 The best scores are: opt bits E(32554) CCDS6571.1 CCL21 gene_id:6366|Hs108|chr9 ( 134) 919 191.3 1.5e-49 >>CCDS6571.1 CCL21 gene_id:6366|Hs108|chr9 (134 aa) initn: 919 init1: 919 opt: 919 Z-score: 1002.9 bits: 191.3 E(32554): 1.5e-49 Smith-Waterman score: 919; 100.0% identity (100.0% similar) in 134 aa overlap (1-134:1-134) 10 20 30 40 50 60 pF1KB6 MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK 70 80 90 100 110 120 130 pF1KB6 GCKRTERSQTPKGP :::::::::::::: CCDS65 GCKRTERSQTPKGP 130 134 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:34:39 2016 done: Fri Nov 4 23:34:39 2016 Total Scan time: 1.530 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]