Result of FASTA (ccds) for pF1KB6731
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB6731, 95 aa
  1>>>pF1KB6731 95 - 95 aa - 95 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9760+/-0.000634; mu= 10.0599+/- 0.038
 mean_var=52.8227+/-10.440, 0's: 0 Z-trim(109.0): 12  B-trim: 0 in 0/53
 Lambda= 0.176467
 statistics sampled from 10580 (10590) to 10580 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.325), width:  16
 Scan time:  1.460

The best scores are:                                      opt bits E(32554)
CCDS4722.1 LSM2 gene_id:57819|Hs108|chr6           (  95)  615 163.8 1.4e-41


>>CCDS4722.1 LSM2 gene_id:57819|Hs108|chr6                (95 aa)
 initn: 615 init1: 615 opt: 615  Z-score: 859.9  bits: 163.8 E(32554): 1.4e-41
Smith-Waterman score: 615; 100.0% identity (100.0% similar) in 95 aa overlap (1-95:1-95)

               10        20        30        40        50        60
pF1KB6 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS47 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
               10        20        30        40        50        60

               70        80        90     
pF1KB6 FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
       :::::::::::::::::::::::::::::::::::
CCDS47 FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
               70        80        90     




95 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 23:40:31 2016 done: Fri Nov  4 23:40:31 2016
 Total Scan time:  1.460 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com