Result of FASTA (ccds) for pF1KB6755
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB6755, 105 aa
  1>>>pF1KB6755 105 - 105 aa - 105 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7354+/-0.000522; mu= 12.2818+/- 0.031
 mean_var=49.7093+/-10.206, 0's: 0 Z-trim(112.3): 10  B-trim: 740 in 1/49
 Lambda= 0.181910
 statistics sampled from 13120 (13123) to 13120 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.791), E-opt: 0.2 (0.403), width:  16
 Scan time:  1.560

The best scores are:                                      opt bits E(32554)
CCDS9901.1 NDUFB1 gene_id:4707|Hs108|chr14         ( 105)  733 198.9 4.7e-52


>>CCDS9901.1 NDUFB1 gene_id:4707|Hs108|chr14              (105 aa)
 initn: 733 init1: 733 opt: 733  Z-score: 1048.1  bits: 198.9 E(32554): 4.7e-52
Smith-Waterman score: 733; 100.0% identity (100.0% similar) in 105 aa overlap (1-105:1-105)

               10        20        30        40        50        60
pF1KB6 MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS99 MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWV
               10        20        30        40        50        60

               70        80        90       100     
pF1KB6 HVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
       :::::::::::::::::::::::::::::::::::::::::::::
CCDS99 HVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
               70        80        90       100     




105 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 23:49:29 2016 done: Fri Nov  4 23:49:29 2016
 Total Scan time:  1.560 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com