FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6775, 118 aa 1>>>pF1KB6775 118 - 118 aa - 118 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1395+/-0.000618; mu= 11.4377+/- 0.037 mean_var=57.7574+/-11.306, 0's: 0 Z-trim(111.0): 11 B-trim: 0 in 0/50 Lambda= 0.168760 statistics sampled from 12012 (12020) to 12012 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.758), E-opt: 0.2 (0.369), width: 16 Scan time: 1.220 The best scores are: opt bits E(32554) CCDS33053.1 SNRPD2 gene_id:6633|Hs108|chr19 ( 118) 769 194.5 1.3e-50 CCDS54281.1 SNRPD2 gene_id:6633|Hs108|chr19 ( 108) 707 179.4 4.1e-46 >>CCDS33053.1 SNRPD2 gene_id:6633|Hs108|chr19 (118 aa) initn: 769 init1: 769 opt: 769 Z-score: 1022.3 bits: 194.5 E(32554): 1.3e-50 Smith-Waterman score: 769; 100.0% identity (100.0% similar) in 118 aa overlap (1-118:1-118) 10 20 30 40 50 60 pF1KB6 MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD 10 20 30 40 50 60 70 80 90 100 110 pF1KB6 RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK 70 80 90 100 110 >>CCDS54281.1 SNRPD2 gene_id:6633|Hs108|chr19 (108 aa) initn: 707 init1: 707 opt: 707 Z-score: 941.3 bits: 179.4 E(32554): 4.1e-46 Smith-Waterman score: 707; 100.0% identity (100.0% similar) in 108 aa overlap (11-118:1-108) 10 20 30 40 50 60 pF1KB6 MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD :::::::::::::::::::::::::::::::::::::::::::::::::: CCDS54 MTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD 10 20 30 40 50 70 80 90 100 110 pF1KB6 RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS54 RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK 60 70 80 90 100 118 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:57:43 2016 done: Fri Nov 4 23:57:43 2016 Total Scan time: 1.220 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]