FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6783, 121 aa 1>>>pF1KB6783 121 - 121 aa - 121 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2305+/-0.000732; mu= 9.8122+/- 0.044 mean_var=49.3056+/- 9.771, 0's: 0 Z-trim(106.4): 12 B-trim: 0 in 0/48 Lambda= 0.182653 statistics sampled from 8941 (8943) to 8941 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.683), E-opt: 0.2 (0.275), width: 16 Scan time: 1.380 The best scores are: opt bits E(32554) CCDS5356.1 RPA3 gene_id:6119|Hs108|chr7 ( 121) 813 221.6 9.5e-59 >>CCDS5356.1 RPA3 gene_id:6119|Hs108|chr7 (121 aa) initn: 813 init1: 813 opt: 813 Z-score: 1168.2 bits: 221.6 E(32554): 9.5e-59 Smith-Waterman score: 813; 100.0% identity (100.0% similar) in 121 aa overlap (1-121:1-121) 10 20 30 40 50 60 pF1KB6 MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS53 MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS53 EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH 70 80 90 100 110 120 pF1KB6 D : CCDS53 D 121 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 23:59:56 2016 done: Fri Nov 4 23:59:56 2016 Total Scan time: 1.380 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]