FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6801, 158 aa 1>>>pF1KB6801 158 - 158 aa - 158 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9268+/-0.000713; mu= 9.8929+/- 0.043 mean_var=86.0196+/-17.504, 0's: 0 Z-trim(110.9): 6 B-trim: 212 in 1/52 Lambda= 0.138285 statistics sampled from 11935 (11938) to 11935 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.745), E-opt: 0.2 (0.367), width: 16 Scan time: 1.950 The best scores are: opt bits E(32554) CCDS7285.1 SRGN gene_id:5552|Hs108|chr10 ( 158) 1057 219.8 5.5e-58 >>CCDS7285.1 SRGN gene_id:5552|Hs108|chr10 (158 aa) initn: 1057 init1: 1057 opt: 1057 Z-score: 1154.5 bits: 219.8 E(32554): 5.5e-58 Smith-Waterman score: 1057; 99.4% identity (100.0% similar) in 158 aa overlap (1-158:1-158) 10 20 30 40 50 60 pF1KB6 MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDSNSANCLEEKGPMFELL ::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: CCDS72 MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 PGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS72 PGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY 70 80 90 100 110 120 130 140 150 pF1KB6 QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML :::::::::::::::::::::::::::::::::::::: CCDS72 QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML 130 140 150 158 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 04:06:50 2016 done: Sat Nov 5 04:06:50 2016 Total Scan time: 1.950 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]