FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6861, 179 aa 1>>>pF1KB6861 179 - 179 aa - 179 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3495+/-0.00053; mu= 14.3059+/- 0.032 mean_var=80.2147+/-15.810, 0's: 0 Z-trim(115.8): 4 B-trim: 0 in 0/54 Lambda= 0.143201 statistics sampled from 16333 (16336) to 16333 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.843), E-opt: 0.2 (0.502), width: 16 Scan time: 2.170 The best scores are: opt bits E(32554) CCDS6352.1 NDUFB9 gene_id:4715|Hs108|chr8 ( 179) 1311 279.0 1.1e-75 CCDS83324.1 NDUFB9 gene_id:4715|Hs108|chr8 ( 168) 1016 218.0 2.3e-57 >>CCDS6352.1 NDUFB9 gene_id:4715|Hs108|chr8 (179 aa) initn: 1311 init1: 1311 opt: 1311 Z-score: 1472.2 bits: 279.0 E(32554): 1.1e-75 Smith-Waterman score: 1311; 100.0% identity (100.0% similar) in 179 aa overlap (1-179:1-179) 10 20 30 40 50 60 pF1KB6 MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS63 MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS63 TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA 70 80 90 100 110 120 130 140 150 160 170 pF1KB6 KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS63 KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM 130 140 150 160 170 >>CCDS83324.1 NDUFB9 gene_id:4715|Hs108|chr8 (168 aa) initn: 1016 init1: 1016 opt: 1016 Z-score: 1143.2 bits: 218.0 E(32554): 2.3e-57 Smith-Waterman score: 1197; 93.9% identity (93.9% similar) in 179 aa overlap (1-179:1-168) 10 20 30 40 50 60 pF1KB6 MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA ::::::::::::::::::::::::::::::::: :::::::::::::::: CCDS83 MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQ-----------RARFEEHKNEKDMAKA 10 20 30 40 70 80 90 100 110 120 pF1KB6 TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS83 TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA 50 60 70 80 90 100 130 140 150 160 170 pF1KB6 KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS83 KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM 110 120 130 140 150 160 179 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 00:05:51 2016 done: Sat Nov 5 00:05:52 2016 Total Scan time: 2.170 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]