FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6866, 196 aa 1>>>pF1KB6866 196 - 196 aa - 196 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.2175+/-0.000645; mu= 10.7496+/- 0.039 mean_var=108.1000+/-21.509, 0's: 0 Z-trim(114.5): 5 B-trim: 72 in 1/52 Lambda= 0.123356 statistics sampled from 15063 (15068) to 15063 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.8), E-opt: 0.2 (0.463), width: 16 Scan time: 2.360 The best scores are: opt bits E(32554) CCDS6582.1 SIT1 gene_id:27240|Hs108|chr9 ( 196) 1335 247.0 5.5e-66 >>CCDS6582.1 SIT1 gene_id:27240|Hs108|chr9 (196 aa) initn: 1335 init1: 1335 opt: 1335 Z-score: 1298.1 bits: 247.0 E(32554): 5.5e-66 Smith-Waterman score: 1335; 100.0% identity (100.0% similar) in 196 aa overlap (1-196:1-196) 10 20 30 40 50 60 pF1KB6 MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 AHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 AHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARA 70 80 90 100 110 120 130 140 150 160 170 180 pF1KB6 AEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRAR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 AEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRAR 130 140 150 160 170 180 190 pF1KB6 ASFPDQAYANSQPAAS :::::::::::::::: CCDS65 ASFPDQAYANSQPAAS 190 196 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 14:07:50 2016 done: Sat Nov 5 14:07:51 2016 Total Scan time: 2.360 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]