FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6894, 202 aa 1>>>pF1KB6894 202 - 202 aa - 202 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8061+/-0.000319; mu= 15.9255+/- 0.020 mean_var=58.8625+/-11.914, 0's: 0 Z-trim(115.5): 19 B-trim: 0 in 0/52 Lambda= 0.167169 statistics sampled from 25970 (25981) to 25970 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.702), E-opt: 0.2 (0.305), width: 16 Scan time: 6.120 The best scores are: opt bits E(85289) NP_002300 (OMIM: 159540) leukemia inhibitory facto ( 202) 1352 333.9 1e-91 >>NP_002300 (OMIM: 159540) leukemia inhibitory factor is (202 aa) initn: 1352 init1: 1352 opt: 1352 Z-score: 1767.5 bits: 333.9 E(85289): 1e-91 Smith-Waterman score: 1352; 100.0% identity (100.0% similar) in 202 aa overlap (1-202:1-202) 10 20 30 40 50 60 pF1KB6 MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB6 ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT 70 80 90 100 110 120 130 140 150 160 170 180 pF1KB6 RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK 130 140 150 160 170 180 190 200 pF1KB6 KKLGCQLLGKYKQIIAVLAQAF :::::::::::::::::::::: NP_002 KKLGCQLLGKYKQIIAVLAQAF 190 200 202 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 14:12:22 2016 done: Sat Nov 5 14:12:23 2016 Total Scan time: 6.120 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]