FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB7215, 111 aa
  1>>>pF1KB7215 111 - 111 aa - 111 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6936+/-0.000539; mu= 14.2281+/- 0.033
 mean_var=71.3886+/-13.402, 0's: 0 Z-trim(115.5): 23  B-trim: 0 in 0/50
 Lambda= 0.151796
 statistics sampled from 15990 (16013) to 15990 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.845), E-opt: 0.2 (0.492), width:  16
 Scan time:  1.710

The best scores are:                                      opt bits E(32554)
CCDS13343.1 WFDC12 gene_id:128488|Hs108|chr20      ( 111)  804 183.6 2.2e-47


>>CCDS13343.1 WFDC12 gene_id:128488|Hs108|chr20           (111 aa)
 initn: 804 init1: 804 opt: 804  Z-score: 964.1  bits: 183.6 E(32554): 2.2e-47
Smith-Waterman score: 804; 100.0% identity (100.0% similar) in 111 aa overlap (1-111:1-111)

               10        20        30        40        50        60
pF1KB7 MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERK
               10        20        30        40        50        60

               70        80        90       100       110 
pF1KB7 CCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
       :::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 CCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
               70        80        90       100       110 




111 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 06:01:47 2016 done: Fri Nov  4 06:01:47 2016
 Total Scan time:  1.710 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]