FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB7501, 58 aa
  1>>>pF1KB7501 58 - 58 aa - 58 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1259+/-0.00042; mu= 6.9130+/- 0.025
 mean_var=63.4229+/-13.231, 0's: 0 Z-trim(117.6): 1  B-trim: 0 in 0/54
 Lambda= 0.161046
 statistics sampled from 18359 (18360) to 18359 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.892), E-opt: 0.2 (0.564), width:  16
 Scan time:  1.230

The best scores are:                                      opt bits E(32554)
CCDS6285.1 POLR2K gene_id:5440|Hs108|chr8          (  58)  417 103.8 6.1e-24


>>CCDS6285.1 POLR2K gene_id:5440|Hs108|chr8               (58 aa)
 initn: 417 init1: 417 opt: 417  Z-score: 543.3  bits: 103.8 E(32554): 6.1e-24
Smith-Waterman score: 417; 100.0% identity (100.0% similar) in 58 aa overlap (1-58:1-58)

               10        20        30        40        50        
pF1KB7 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS62 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
               10        20        30        40        50        




58 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 07:58:41 2016 done: Fri Nov  4 07:58:42 2016
 Total Scan time:  1.230 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]