FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB7571, 205 aa 1>>>pF1KB7571 205 - 205 aa - 205 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 9.6164+/-0.000286; mu= -3.5060+/- 0.018 mean_var=243.5838+/-48.594, 0's: 0 Z-trim(125.9): 11 B-trim: 88 in 1/61 Lambda= 0.082177 statistics sampled from 50626 (50647) to 50626 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.859), E-opt: 0.2 (0.594), width: 16 Scan time: 7.420 The best scores are: opt bits E(85289) NP_006433 (OMIM: 602289) dr1-associated corepresso ( 205) 1387 175.7 4.5e-44 >>NP_006433 (OMIM: 602289) dr1-associated corepressor [H (205 aa) initn: 1387 init1: 1387 opt: 1387 Z-score: 912.2 bits: 175.7 E(85289): 4.5e-44 Smith-Waterman score: 1387; 100.0% identity (100.0% similar) in 205 aa overlap (1-205:1-205) 10 20 30 40 50 60 pF1KB7 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB7 NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK 70 80 90 100 110 120 130 140 150 160 170 180 pF1KB7 NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA 130 140 150 160 170 180 190 200 pF1KB7 STLPLPPAPPGPSAPDEEDEEDYDS ::::::::::::::::::::::::: NP_006 STLPLPPAPPGPSAPDEEDEEDYDS 190 200 205 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 08:47:03 2016 done: Fri Nov 4 08:47:04 2016 Total Scan time: 7.420 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]