FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB7907, 131 aa 1>>>pF1KB7907 131 - 131 aa - 131 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9531+/-0.000765; mu= 7.3102+/- 0.046 mean_var=67.3136+/-13.295, 0's: 0 Z-trim(108.4): 13 B-trim: 0 in 0/50 Lambda= 0.156323 statistics sampled from 10179 (10182) to 10179 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.693), E-opt: 0.2 (0.313), width: 16 Scan time: 1.610 The best scores are: opt bits E(32554) CCDS11078.1 MED31 gene_id:51003|Hs108|chr17 ( 131) 896 210.5 2.5e-55 >>CCDS11078.1 MED31 gene_id:51003|Hs108|chr17 (131 aa) initn: 896 init1: 896 opt: 896 Z-score: 1106.9 bits: 210.5 E(32554): 2.5e-55 Smith-Waterman score: 896; 100.0% identity (100.0% similar) in 131 aa overlap (1-131:1-131) 10 20 30 40 50 60 pF1KB7 MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKD 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB7 PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA 70 80 90 100 110 120 130 pF1KB7 EQQQQNNTSGK ::::::::::: CCDS11 EQQQQNNTSGK 130 131 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 10:08:57 2016 done: Sat Nov 5 10:08:57 2016 Total Scan time: 1.610 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]