FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB7913, 161 aa 1>>>pF1KB7913 161 - 161 aa - 161 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.5951+/-0.0006; mu= 12.8357+/- 0.037 mean_var=88.2914+/-17.331, 0's: 0 Z-trim(114.7): 20 B-trim: 188 in 1/54 Lambda= 0.136494 statistics sampled from 15194 (15214) to 15194 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.808), E-opt: 0.2 (0.467), width: 16 Scan time: 2.070 The best scores are: opt bits E(32554) CCDS326.1 TAF12 gene_id:6883|Hs108|chr1 ( 161) 1059 217.0 4e-57 >>CCDS326.1 TAF12 gene_id:6883|Hs108|chr1 (161 aa) initn: 1059 init1: 1059 opt: 1059 Z-score: 1139.0 bits: 217.0 E(32554): 4e-57 Smith-Waterman score: 1059; 100.0% identity (100.0% similar) in 161 aa overlap (1-161:1-161) 10 20 30 40 50 60 pF1KB7 MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB7 KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL 70 80 90 100 110 120 130 140 150 160 pF1KB7 ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK ::::::::::::::::::::::::::::::::::::::::: CCDS32 ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 130 140 150 160 161 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 14:36:18 2016 done: Sat Nov 5 14:36:18 2016 Total Scan time: 2.070 Total Display time: 0.000 Function used was FASTA [36.3.4 Apr, 2011]