FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB7930, 213 aa 1>>>pF1KB7930 213 - 213 aa - 213 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.5485+/-0.000649; mu= 6.4643+/- 0.040 mean_var=148.0502+/-29.698, 0's: 0 Z-trim(117.0): 15 B-trim: 146 in 1/54 Lambda= 0.105407 statistics sampled from 17679 (17694) to 17679 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.841), E-opt: 0.2 (0.544), width: 16 Scan time: 2.270 The best scores are: opt bits E(32554) CCDS6136.1 THAP1 gene_id:55145|Hs108|chr8 ( 213) 1486 236.0 1.3e-62 >>CCDS6136.1 THAP1 gene_id:55145|Hs108|chr8 (213 aa) initn: 1486 init1: 1486 opt: 1486 Z-score: 1237.5 bits: 236.0 E(32554): 1.3e-62 Smith-Waterman score: 1486; 100.0% identity (100.0% similar) in 213 aa overlap (1-213:1-213) 10 20 30 40 50 60 pF1KB7 MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS61 MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB7 DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLM :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS61 DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLM 70 80 90 100 110 120 130 140 150 160 170 180 pF1KB7 PPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS61 PPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKL 130 140 150 160 170 180 190 200 210 pF1KB7 KEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA ::::::::::::::::::::::::::::::::: CCDS61 KEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA 190 200 210 213 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 10:11:43 2016 done: Sat Nov 5 10:11:43 2016 Total Scan time: 2.270 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]