FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8163, 123 aa 1>>>pF1KB8163 123 - 123 aa - 123 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7085+/-0.000562; mu= 13.9068+/- 0.034 mean_var=53.7371+/-10.678, 0's: 0 Z-trim(112.7): 6 B-trim: 549 in 1/50 Lambda= 0.174959 statistics sampled from 13445 (13447) to 13445 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.798), E-opt: 0.2 (0.413), width: 16 Scan time: 1.500 The best scores are: opt bits E(32554) CCDS1428.1 RABIF gene_id:5877|Hs108|chr1 ( 123) 858 223.3 2.9e-59 >>CCDS1428.1 RABIF gene_id:5877|Hs108|chr1 (123 aa) initn: 858 init1: 858 opt: 858 Z-score: 1177.5 bits: 223.3 E(32554): 2.9e-59 Smith-Waterman score: 858; 100.0% identity (100.0% similar) in 123 aa overlap (1-123:1-123) 10 20 30 40 50 60 pF1KB8 MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB8 DGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 DGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERV 70 80 90 100 110 120 pF1KB8 SHE ::: CCDS14 SHE 123 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 10:09:11 2016 done: Fri Nov 4 10:09:11 2016 Total Scan time: 1.500 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]