FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8250, 122 aa 1>>>pF1KB8250 122 - 122 aa - 122 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.5313+/-0.000976; mu= 1.1723+/- 0.059 mean_var=120.0501+/-23.441, 0's: 0 Z-trim(107.7): 13 B-trim: 15 in 1/51 Lambda= 0.117056 statistics sampled from 9769 (9772) to 9769 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.643), E-opt: 0.2 (0.3), width: 16 Scan time: 1.450 The best scores are: opt bits E(32554) CCDS4222.1 PFDN1 gene_id:5201|Hs108|chr5 ( 122) 747 136.3 4.6e-33 >>CCDS4222.1 PFDN1 gene_id:5201|Hs108|chr5 (122 aa) initn: 747 init1: 747 opt: 747 Z-score: 707.1 bits: 136.3 E(32554): 4.6e-33 Smith-Waterman score: 747; 100.0% identity (100.0% similar) in 122 aa overlap (1-122:1-122) 10 20 30 40 50 60 pF1KB8 MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB8 YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARR 70 80 90 100 110 120 pF1KB8 AQ :: CCDS42 AQ 122 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 11:01:33 2016 done: Fri Nov 4 11:01:33 2016 Total Scan time: 1.450 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]