Result of FASTA (ccds) for pF1KB8309
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8309, 68 aa
  1>>>pF1KB8309 68 - 68 aa - 68 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6387+/-0.000495; mu= 10.9153+/- 0.030
 mean_var=68.0351+/-13.018, 0's: 0 Z-trim(115.8): 9  B-trim: 47 in 1/51
 Lambda= 0.155492
 statistics sampled from 16335 (16342) to 16335 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.856), E-opt: 0.2 (0.502), width:  16
 Scan time:  1.170

The best scores are:                                      opt bits E(32554)
CCDS14764.1 CMC4 gene_id:100272147|Hs108|chrX      (  68)  476 113.9 7.5e-27


>>CCDS14764.1 CMC4 gene_id:100272147|Hs108|chrX           (68 aa)
 initn: 476 init1: 476 opt: 476  Z-score: 595.5  bits: 113.9 E(32554): 7.5e-27
Smith-Waterman score: 476; 100.0% identity (100.0% similar) in 68 aa overlap (1-68:1-68)

               10        20        30        40        50        60
pF1KB8 MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
               10        20        30        40        50        60

               
pF1KB8 LTRKSASK
       ::::::::
CCDS14 LTRKSASK
               




68 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 11:36:07 2016 done: Fri Nov  4 11:36:07 2016
 Total Scan time:  1.170 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com