FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8441, 160 aa 1>>>pF1KB8441 160 - 160 aa - 160 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5010+/-0.000642; mu= 16.8472+/- 0.039 mean_var=58.0298+/-11.488, 0's: 0 Z-trim(110.2): 4 B-trim: 0 in 0/51 Lambda= 0.168364 statistics sampled from 11424 (11425) to 11424 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.741), E-opt: 0.2 (0.351), width: 16 Scan time: 1.900 The best scores are: opt bits E(32554) CCDS14044.1 BIK gene_id:638|Hs108|chr22 ( 160) 1045 261.2 2e-70 >>CCDS14044.1 BIK gene_id:638|Hs108|chr22 (160 aa) initn: 1045 init1: 1045 opt: 1045 Z-score: 1377.9 bits: 261.2 E(32554): 2e-70 Smith-Waterman score: 1045; 100.0% identity (100.0% similar) in 160 aa overlap (1-160:1-160) 10 20 30 40 50 60 pF1KB8 MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB8 LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR 70 80 90 100 110 120 130 140 150 160 pF1KB8 FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK :::::::::::::::::::::::::::::::::::::::: CCDS14 FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK 130 140 150 160 160 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 12:55:11 2016 done: Fri Nov 4 12:55:12 2016 Total Scan time: 1.900 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]