FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8739, 52 aa
  1>>>pF1KB8739 52 - 52 aa - 52 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 3.9551+/-0.000256; mu= 12.1659+/- 0.016
 mean_var=45.0635+/- 9.018, 0's: 0 Z-trim(119.4): 1  B-trim: 1061 in 1/54
 Lambda= 0.191056
 statistics sampled from 33336 (33337) to 33336 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.787), E-opt: 0.2 (0.391), width:  16
 Scan time:  3.340

The best scores are:                                      opt bits E(85289)
NP_002658 (OMIM: 172405,609909,613874) cardiac pho (  52)  330 96.9 1.6e-21


>>NP_002658 (OMIM: 172405,609909,613874) cardiac phospho  (52 aa)
 initn: 330 init1: 330 opt: 330  Z-score: 507.5  bits: 96.9 E(85289): 1.6e-21
Smith-Waterman score: 330; 100.0% identity (100.0% similar) in 52 aa overlap (1-52:1-52)

               10        20        30        40        50  
pF1KB8 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_002 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
               10        20        30        40        50  




52 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 15:07:19 2016 done: Fri Nov  4 15:07:19 2016
 Total Scan time:  3.340 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]