Result of FASTA (ccds) for pF1KB8848
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8848, 67 aa
  1>>>pF1KB8848 67 - 67 aa - 67 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0936+/-0.00049; mu= 7.0284+/- 0.029
 mean_var=46.4936+/- 9.629, 0's: 0 Z-trim(113.4): 5  B-trim: 0 in 0/51
 Lambda= 0.188095
 statistics sampled from 14036 (14039) to 14036 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.814), E-opt: 0.2 (0.431), width:  16
 Scan time:  1.320

The best scores are:                                      opt bits E(32554)
CCDS7720.1 POLR2L gene_id:5441|Hs108|chr11         (  67)  459 131.0 5.3e-32


>>CCDS7720.1 POLR2L gene_id:5441|Hs108|chr11              (67 aa)
 initn: 459 init1: 459 opt: 459  Z-score: 688.0  bits: 131.0 E(32554): 5.3e-32
Smith-Waterman score: 459; 100.0% identity (100.0% similar) in 67 aa overlap (1-67:1-67)

               10        20        30        40        50        60
pF1KB8 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS77 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
               10        20        30        40        50        60

              
pF1KB8 NYAPLEK
       :::::::
CCDS77 NYAPLEK
              




67 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 16:05:51 2016 done: Fri Nov  4 16:05:51 2016
 Total Scan time:  1.320 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com