Result of FASTA (omim) for pF1KB8848
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8848, 67 aa
  1>>>pF1KB8848 67 - 67 aa - 67 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7005+/-0.000254; mu= 9.2381+/- 0.016
 mean_var=45.3238+/- 9.365, 0's: 0 Z-trim(120.0): 1  B-trim: 0 in 0/55
 Lambda= 0.190507
 statistics sampled from 34696 (34697) to 34696 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.794), E-opt: 0.2 (0.407), width:  16
 Scan time:  3.510

The best scores are:                                      opt bits E(85289)
NP_066951 (OMIM: 601189) DNA-directed RNA polymera (  67)  459 132.4 5.2e-32


>>NP_066951 (OMIM: 601189) DNA-directed RNA polymerases   (67 aa)
 initn: 459 init1: 459 opt: 459  Z-score: 695.7  bits: 132.4 E(85289): 5.2e-32
Smith-Waterman score: 459; 100.0% identity (100.0% similar) in 67 aa overlap (1-67:1-67)

               10        20        30        40        50        60
pF1KB8 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_066 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
               10        20        30        40        50        60

              
pF1KB8 NYAPLEK
       :::::::
NP_066 NYAPLEK
              




67 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 16:05:51 2016 done: Fri Nov  4 16:05:52 2016
 Total Scan time:  3.510 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com