FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8849, 71 aa 1>>>pF1KB8849 71 - 71 aa - 71 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8153+/-0.00065; mu= 8.6563+/- 0.039 mean_var=44.5021+/- 9.081, 0's: 0 Z-trim(108.0): 6 B-trim: 177 in 1/49 Lambda= 0.192258 statistics sampled from 9932 (9935) to 9932 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.713), E-opt: 0.2 (0.305), width: 16 Scan time: 1.140 The best scores are: opt bits E(32554) CCDS5256.1 GTF2H5 gene_id:404672|Hs108|chr6 ( 71) 451 131.8 3.4e-32 >>CCDS5256.1 GTF2H5 gene_id:404672|Hs108|chr6 (71 aa) initn: 451 init1: 451 opt: 451 Z-score: 691.6 bits: 131.8 E(32554): 3.4e-32 Smith-Waterman score: 451; 100.0% identity (100.0% similar) in 71 aa overlap (1-71:1-71) 10 20 30 40 50 60 pF1KB8 MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS52 MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL 10 20 30 40 50 60 70 pF1KB8 MDQNAFSLTQK ::::::::::: CCDS52 MDQNAFSLTQK 70 71 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 16:06:19 2016 done: Fri Nov 4 16:06:19 2016 Total Scan time: 1.140 Total Display time: 0.010 Function used was FASTA [36.3.4 Apr, 2011]