FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8853, 76 aa 1>>>pF1KB8853 76 - 76 aa - 76 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1943+/-0.000614; mu= 7.5321+/- 0.037 mean_var=49.7370+/- 9.666, 0's: 0 Z-trim(109.4): 8 B-trim: 9 in 1/49 Lambda= 0.181859 statistics sampled from 10836 (10840) to 10836 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.333), width: 16 Scan time: 1.360 The best scores are: opt bits E(32554) CCDS6222.1 PKIA gene_id:5569|Hs108|chr8 ( 76) 463 128.5 3.9e-31 >>CCDS6222.1 PKIA gene_id:5569|Hs108|chr8 (76 aa) initn: 463 init1: 463 opt: 463 Z-score: 672.5 bits: 128.5 E(32554): 3.9e-31 Smith-Waterman score: 463; 100.0% identity (100.0% similar) in 76 aa overlap (1-76:1-76) 10 20 30 40 50 60 pF1KB8 MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS62 MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS 10 20 30 40 50 60 70 pF1KB8 TEQSGEAQGEAAKSES :::::::::::::::: CCDS62 TEQSGEAQGEAAKSES 70 76 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 16:07:20 2016 done: Fri Nov 4 16:07:21 2016 Total Scan time: 1.360 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]