FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8866, 115 aa
  1>>>pF1KB8866 115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0676+/-0.000673; mu= 11.8749+/- 0.041
 mean_var=60.0796+/-11.739, 0's: 0 Z-trim(110.0): 12  B-trim: 0 in 0/49
 Lambda= 0.165467
 statistics sampled from 11302 (11307) to 11302 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.748), E-opt: 0.2 (0.347), width:  16
 Scan time:  1.620

The best scores are:                                      opt bits E(32554)
CCDS7812.1 PTH gene_id:5741|Hs108|chr11            ( 115)  739 183.9 1.9e-47


>>CCDS7812.1 PTH gene_id:5741|Hs108|chr11                 (115 aa)
 initn: 739 init1: 739 opt: 739  Z-score: 965.3  bits: 183.9 E(32554): 1.9e-47
Smith-Waterman score: 739; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KB8 MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS78 MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KB8 DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS78 DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
               70        80        90       100       110     




115 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 16:14:04 2016 done: Fri Nov  4 16:14:04 2016
 Total Scan time:  1.620 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]