FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB8868, 126 aa 1>>>pF1KB8868 126 - 126 aa - 126 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.0697+/-0.000247; mu= 4.9069+/- 0.016 mean_var=127.0153+/-25.477, 0's: 0 Z-trim(125.2): 2 B-trim: 1751 in 2/57 Lambda= 0.113801 statistics sampled from 48458 (48460) to 48458 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.859), E-opt: 0.2 (0.568), width: 16 Scan time: 5.360 The best scores are: opt bits E(85289) XP_011509547 (OMIM: 600296) PREDICTED: C-type natr ( 126) 852 149.1 1.8e-36 NP_077720 (OMIM: 600296) C-type natriuretic peptid ( 126) 852 149.1 1.8e-36 >>XP_011509547 (OMIM: 600296) PREDICTED: C-type natriure (126 aa) initn: 852 init1: 852 opt: 852 Z-score: 775.7 bits: 149.1 E(85289): 1.8e-36 Smith-Waterman score: 852; 100.0% identity (100.0% similar) in 126 aa overlap (1-126:1-126) 10 20 30 40 50 60 pF1KB8 MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB8 GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS 70 80 90 100 110 120 pF1KB8 MSGLGC :::::: XP_011 MSGLGC >>NP_077720 (OMIM: 600296) C-type natriuretic peptide pr (126 aa) initn: 852 init1: 852 opt: 852 Z-score: 775.7 bits: 149.1 E(85289): 1.8e-36 Smith-Waterman score: 852; 100.0% identity (100.0% similar) in 126 aa overlap (1-126:1-126) 10 20 30 40 50 60 pF1KB8 MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_077 MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB8 GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_077 GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS 70 80 90 100 110 120 pF1KB8 MSGLGC :::::: NP_077 MSGLGC 126 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 16:15:12 2016 done: Fri Nov 4 16:15:13 2016 Total Scan time: 5.360 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]