Result of FASTA (ccds) for pF1KB9547
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB9547, 110 aa
  1>>>pF1KB9547 110 - 110 aa - 110 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.9503+/-0.000714; mu= 7.3789+/- 0.043
 mean_var=103.3092+/-20.099, 0's: 0 Z-trim(113.0): 11  B-trim: 51 in 2/48
 Lambda= 0.126184
 statistics sampled from 13704 (13712) to 13704 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.79), E-opt: 0.2 (0.421), width:  16
 Scan time:  1.200

The best scores are:                                      opt bits E(32554)
CCDS14016.1 PHF5A gene_id:84844|Hs108|chr22        ( 110)  816 157.8 1.3e-39


>>CCDS14016.1 PHF5A gene_id:84844|Hs108|chr22             (110 aa)
 initn: 816 init1: 816 opt: 816  Z-score: 824.8  bits: 157.8 E(32554): 1.3e-39
Smith-Waterman score: 816; 100.0% identity (100.0% similar) in 110 aa overlap (1-110:1-110)

               10        20        30        40        50        60
pF1KB9 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
               10        20        30        40        50        60

               70        80        90       100       110
pF1KB9 CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
       ::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
               70        80        90       100       110




110 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 02:05:48 2016 done: Sat Nov  5 02:05:48 2016
 Total Scan time:  1.200 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com