Result of FASTA (ccds) for pF1KB9675
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB9675, 84 aa
  1>>>pF1KB9675 84 - 84 aa - 84 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2029+/-0.000479; mu= 9.0630+/- 0.029
 mean_var=57.7335+/-11.570, 0's: 0 Z-trim(114.6): 4  B-trim: 0 in 0/51
 Lambda= 0.168795
 statistics sampled from 15151 (15153) to 15151 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.839), E-opt: 0.2 (0.465), width:  16
 Scan time:  1.520

The best scores are:                                      opt bits E(32554)
CCDS31051.1 TAF5L gene_id:27097|Hs108|chr1         ( 325)  302 80.7 4.6e-16
CCDS1581.1 TAF5L gene_id:27097|Hs108|chr1          ( 589)  302 80.8 7.7e-16


>>CCDS31051.1 TAF5L gene_id:27097|Hs108|chr1              (325 aa)
 initn: 323 init1: 300 opt: 302  Z-score: 401.9  bits: 80.7 E(32554): 4.6e-16
Smith-Waterman score: 302; 75.7% identity (85.7% similar) in 70 aa overlap (1-67:1-70)

               10        20        30        40        50          
pF1KB9 MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTGNG-GGSSGGVSL
       ::::::::::::::::::::::::::::::::::::::::::::::: .. .: .. :: 
CCDS31 MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSA
               10        20        30        40        50        60

      60          70        80                                     
pF1KB9 E--QENSRQYPCGITSPLLKTVPERAD                                 
          : . .::                                                  
CCDS31 APCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY
               70        80        90       100       110       120

>>CCDS1581.1 TAF5L gene_id:27097|Hs108|chr1               (589 aa)
 initn: 323 init1: 300 opt: 302  Z-score: 397.8  bits: 80.8 E(32554): 7.7e-16
Smith-Waterman score: 302; 75.7% identity (85.7% similar) in 70 aa overlap (1-67:1-70)

               10        20        30        40        50          
pF1KB9 MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTGNG-GGSSGGVSL
       ::::::::::::::::::::::::::::::::::::::::::::::: .. .: .. :: 
CCDS15 MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSA
               10        20        30        40        50        60

      60          70        80                                     
pF1KB9 E--QENSRQYPCGITSPLLKTVPERAD                                 
          : . .::                                                  
CCDS15 APCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY
               70        80        90       100       110       120




84 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 18:10:17 2016 done: Fri Nov  4 18:10:18 2016
 Total Scan time:  1.520 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com