FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB9677, 104 aa 1>>>pF1KB9677 104 - 104 aa - 104 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.6201+/-0.000272; mu= 0.4360+/- 0.017 mean_var=141.8674+/-27.871, 0's: 0 Z-trim(123.4): 5 B-trim: 407 in 1/56 Lambda= 0.107679 statistics sampled from 43088 (43093) to 43088 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.82), E-opt: 0.2 (0.505), width: 16 Scan time: 4.790 The best scores are: opt bits E(85289) NP_001006640 (OMIM: 300237) transcription elongati ( 159) 266 51.1 5.9e-07 NP_001006641 (OMIM: 300237) transcription elongati ( 159) 266 51.1 5.9e-07 NP_004771 (OMIM: 300237) transcription elongation ( 159) 266 51.1 5.9e-07 XP_016885144 (OMIM: 300771) PREDICTED: transcripti ( 100) 226 44.8 3e-05 NP_689491 (OMIM: 300771) transcription elongation ( 100) 226 44.8 3e-05 >>NP_001006640 (OMIM: 300237) transcription elongation f (159 aa) initn: 314 init1: 250 opt: 266 Z-score: 245.9 bits: 51.1 E(85289): 5.9e-07 Smith-Waterman score: 266; 43.4% identity (74.7% similar) in 99 aa overlap (8-101:65-158) 10 20 30 pF1KB9 MKSCQKMEGKPENESEPKHE--EEPKPEEKPEE---E : .: .:. ... : : :.: . NP_001 EEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGK 40 50 60 70 80 90 40 50 60 70 80 90 pF1KB9 EKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRW .:::: :.:.::: .: .:. :::.:.::::.:.. .::..:..::::::..:.: NP_001 HKLEE-----GSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHW 100 110 120 130 140 100 pF1KB9 KVNRNHPYPYLM :..:..::: NP_001 KAKRSRPYPI 150 >>NP_001006641 (OMIM: 300237) transcription elongation f (159 aa) initn: 314 init1: 250 opt: 266 Z-score: 245.9 bits: 51.1 E(85289): 5.9e-07 Smith-Waterman score: 266; 43.4% identity (74.7% similar) in 99 aa overlap (8-101:65-158) 10 20 30 pF1KB9 MKSCQKMEGKPENESEPKHE--EEPKPEEKPEE---E : .: .:. ... : : :.: . NP_001 EEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGK 40 50 60 70 80 90 40 50 60 70 80 90 pF1KB9 EKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRW .:::: :.:.::: .: .:. :::.:.::::.:.. .::..:..::::::..:.: NP_001 HKLEE-----GSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHW 100 110 120 130 140 100 pF1KB9 KVNRNHPYPYLM :..:..::: NP_001 KAKRSRPYPI 150 >>NP_004771 (OMIM: 300237) transcription elongation fact (159 aa) initn: 314 init1: 250 opt: 266 Z-score: 245.9 bits: 51.1 E(85289): 5.9e-07 Smith-Waterman score: 266; 43.4% identity (74.7% similar) in 99 aa overlap (8-101:65-158) 10 20 30 pF1KB9 MKSCQKMEGKPENESEPKHE--EEPKPEEKPEE---E : .: .:. ... : : :.: . NP_004 EEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGK 40 50 60 70 80 90 40 50 60 70 80 90 pF1KB9 EKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRW .:::: :.:.::: .: .:. :::.:.::::.:.. .::..:..::::::..:.: NP_004 HKLEE-----GSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHW 100 110 120 130 140 100 pF1KB9 KVNRNHPYPYLM :..:..::: NP_004 KAKRSRPYPI 150 >>XP_016885144 (OMIM: 300771) PREDICTED: transcription e (100 aa) initn: 186 init1: 162 opt: 226 Z-score: 215.2 bits: 44.8 E(85289): 3e-05 Smith-Waterman score: 235; 42.5% identity (70.8% similar) in 106 aa overlap (2-101:3-99) 10 20 30 40 50 pF1KB9 MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKED : :.. ::::. : ::.:: ..: : :. ...:.::.::.:::.::::: XP_016 MQKPCKENEGKPKC-SVPKREE-----KRPYGE---FERQQTEGNFRQRLLQSLEEFKED 10 20 30 40 50 60 70 80 90 100 pF1KB9 IHNRHLSNEDMFREVDEID----EIRRVRNKLIVMR--WKVNRNHPYPYLM : ::...:.: :: ::.. ::: .:.:. ... . .:..::: XP_016 IDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI 60 70 80 90 100 >>NP_689491 (OMIM: 300771) transcription elongation fact (100 aa) initn: 186 init1: 162 opt: 226 Z-score: 215.2 bits: 44.8 E(85289): 3e-05 Smith-Waterman score: 235; 42.5% identity (70.8% similar) in 106 aa overlap (2-101:3-99) 10 20 30 40 50 pF1KB9 MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKED : :.. ::::. : ::.:: ..: : :. ...:.::.::.:::.::::: NP_689 MQKPCKENEGKPKC-SVPKREE-----KRPYGE---FERQQTEGNFRQRLLQSLEEFKED 10 20 30 40 50 60 70 80 90 100 pF1KB9 IHNRHLSNEDMFREVDEID----EIRRVRNKLIVMR--WKVNRNHPYPYLM : ::...:.: :: ::.. ::: .:.:. ... . .:..::: NP_689 IDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI 60 70 80 90 100 104 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 18:11:27 2016 done: Fri Nov 4 18:11:27 2016 Total Scan time: 4.790 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]