Result of FASTA (omim) for pF1KB9781
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB9781, 120 aa
  1>>>pF1KB9781 120 - 120 aa - 120 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.1102+/-0.000302; mu= 7.5719+/- 0.019
 mean_var=95.5580+/-18.632, 0's: 0 Z-trim(119.3): 46  B-trim: 0 in 0/54
 Lambda= 0.131202
 statistics sampled from 33200 (33246) to 33200 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.759), E-opt: 0.2 (0.39), width:  16
 Scan time:  4.610

The best scores are:                                      opt bits E(85289)
NP_001301 (OMIM: 603476) cAMP-responsive element-b ( 120)  791 158.8   2e-39


>>NP_001301 (OMIM: 603476) cAMP-responsive element-bindi  (120 aa)
 initn: 791 init1: 791 opt: 791  Z-score: 828.9  bits: 158.8 E(85289): 2e-39
Smith-Waterman score: 791; 100.0% identity (100.0% similar) in 120 aa overlap (1-120:1-120)

               10        20        30        40        50        60
pF1KB9 MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB9 AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
               70        80        90       100       110       120




120 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 18:53:20 2016 done: Fri Nov  4 18:53:21 2016
 Total Scan time:  4.610 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com