Result of FASTA (ccds) for pF1KE0113
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0113, 88 aa
  1>>>pF1KE0113 88 - 88 aa - 88 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4331+/-0.000543; mu= 12.8827+/- 0.033
 mean_var=53.0078+/-10.399, 0's: 0 Z-trim(112.3): 9  B-trim: 0 in 0/52
 Lambda= 0.176159
 statistics sampled from 13065 (13069) to 13065 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.802), E-opt: 0.2 (0.401), width:  16
 Scan time:  1.400

The best scores are:                                      opt bits E(32554)
CCDS10549.1 SNN gene_id:8303|Hs108|chr16           (  88)  582 154.7   7e-39


>>CCDS10549.1 SNN gene_id:8303|Hs108|chr16                (88 aa)
 initn: 582 init1: 582 opt: 582  Z-score: 811.5  bits: 154.7 E(32554): 7e-39
Smith-Waterman score: 582; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88)

               10        20        30        40        50        60
pF1KE0 MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPF
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPF
               10        20        30        40        50        60

               70        80        
pF1KE0 LLVQYSAKGPCVERKAKLMTPNGPEVHG
       ::::::::::::::::::::::::::::
CCDS10 LLVQYSAKGPCVERKAKLMTPNGPEVHG
               70        80        




88 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 02:32:23 2016 done: Fri Nov  4 02:32:23 2016
 Total Scan time:  1.400 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com