FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0157, 129 aa 1>>>pF1KE0157 129 - 129 aa - 129 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0428+/-0.000695; mu= 11.6161+/- 0.042 mean_var=51.2602+/-10.253, 0's: 0 Z-trim(108.3): 6 B-trim: 234 in 2/50 Lambda= 0.179136 statistics sampled from 10098 (10101) to 10098 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.702), E-opt: 0.2 (0.31), width: 16 Scan time: 1.580 The best scores are: opt bits E(32554) CCDS35056.1 ISCA1 gene_id:81689|Hs108|chr9 ( 129) 823 219.9 3.4e-58 >>CCDS35056.1 ISCA1 gene_id:81689|Hs108|chr9 (129 aa) initn: 823 init1: 823 opt: 823 Z-score: 1158.2 bits: 219.9 E(32554): 3.4e-58 Smith-Waterman score: 823; 100.0% identity (100.0% similar) in 129 aa overlap (1-129:1-129) 10 20 30 40 50 60 pF1KE0 MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS35 MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS35 SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 70 80 90 100 110 120 pF1KE0 CGCGESFNI ::::::::: CCDS35 CGCGESFNI 129 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 23:33:06 2016 done: Thu Nov 3 23:33:06 2016 Total Scan time: 1.580 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]