FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0192, 87 aa
  1>>>pF1KE0192 87 - 87 aa - 87 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1601+/-0.000507; mu= 10.4556+/- 0.031
 mean_var=73.0381+/-14.280, 0's: 0 Z-trim(115.6): 6  B-trim: 0 in 0/53
 Lambda= 0.150072
 statistics sampled from 16199 (16204) to 16199 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.847), E-opt: 0.2 (0.498), width:  16
 Scan time:  1.470

The best scores are:                                      opt bits E(32554)
CCDS8225.1 COA4 gene_id:51287|Hs108|chr11          (  87)  623 142.4 3.5e-35


>>CCDS8225.1 COA4 gene_id:51287|Hs108|chr11               (87 aa)
 initn: 623 init1: 623 opt: 623  Z-score: 745.2  bits: 142.4 E(32554): 3.5e-35
Smith-Waterman score: 623; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:1-87)

               10        20        30        40        50        60
pF1KE0 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS82 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA
               10        20        30        40        50        60

               70        80       
pF1KE0 FKDCMSEQQARRQEELQRRQEQAGAHH
       :::::::::::::::::::::::::::
CCDS82 FKDCMSEQQARRQEELQRRQEQAGAHH
               70        80       




87 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 21:47:23 2016 done: Thu Nov  3 21:47:24 2016
 Total Scan time:  1.470 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]