FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0192, 87 aa 1>>>pF1KE0192 87 - 87 aa - 87 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.5232+/-0.000242; mu= 8.2800+/- 0.015 mean_var=74.4238+/-14.755, 0's: 0 Z-trim(123.0): 28 B-trim: 481 in 1/53 Lambda= 0.148668 statistics sampled from 41941 (41969) to 41941 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.841), E-opt: 0.2 (0.492), width: 16 Scan time: 4.130 The best scores are: opt bits E(85289) XP_016873373 (OMIM: 608016) PREDICTED: cytochrome ( 87) 623 141.3 1.9e-34 NP_057649 (OMIM: 608016) cytochrome c oxidase asse ( 87) 623 141.3 1.9e-34 XP_016873372 (OMIM: 608016) PREDICTED: cytochrome ( 96) 623 141.3 2e-34 >>XP_016873373 (OMIM: 608016) PREDICTED: cytochrome c ox (87 aa) initn: 623 init1: 623 opt: 623 Z-score: 739.5 bits: 141.3 E(85289): 1.9e-34 Smith-Waterman score: 623; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:1-87) 10 20 30 40 50 60 pF1KE0 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA 10 20 30 40 50 60 70 80 pF1KE0 FKDCMSEQQARRQEELQRRQEQAGAHH ::::::::::::::::::::::::::: XP_016 FKDCMSEQQARRQEELQRRQEQAGAHH 70 80 >>NP_057649 (OMIM: 608016) cytochrome c oxidase assembly (87 aa) initn: 623 init1: 623 opt: 623 Z-score: 739.5 bits: 141.3 E(85289): 1.9e-34 Smith-Waterman score: 623; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:1-87) 10 20 30 40 50 60 pF1KE0 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_057 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQA 10 20 30 40 50 60 70 80 pF1KE0 FKDCMSEQQARRQEELQRRQEQAGAHH ::::::::::::::::::::::::::: NP_057 FKDCMSEQQARRQEELQRRQEQAGAHH 70 80 >>XP_016873372 (OMIM: 608016) PREDICTED: cytochrome c ox (96 aa) initn: 623 init1: 623 opt: 623 Z-score: 738.9 bits: 141.3 E(85289): 2e-34 Smith-Waterman score: 623; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:10-96) 10 20 30 40 50 pF1KE0 MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDW ::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MFYRLPIPRMSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDW 10 20 30 40 50 60 60 70 80 pF1KE0 RQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAHH :::::::::::::::::::::::::::::::::::: XP_016 RQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAHH 70 80 90 87 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 21:47:24 2016 done: Thu Nov 3 21:47:25 2016 Total Scan time: 4.130 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]