FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE0201, 83 aa
1>>>pF1KE0201 83 - 83 aa - 83 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 4.8782+/-0.000502; mu= 11.2984+/- 0.030
mean_var=59.8578+/-11.839, 0's: 0 Z-trim(114.5): 1 B-trim: 97 in 1/53
Lambda= 0.165773
statistics sampled from 15022 (15023) to 15022 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.834), E-opt: 0.2 (0.461), width: 16
Scan time: 1.530
The best scores are: opt bits E(32554)
CCDS12648.1 APOC1 gene_id:341|Hs108|chr19 ( 83) 515 130.0 1.6e-31
>>CCDS12648.1 APOC1 gene_id:341|Hs108|chr19 (83 aa)
initn: 515 init1: 515 opt: 515 Z-score: 679.2 bits: 130.0 E(32554): 1.6e-31
Smith-Waterman score: 515; 100.0% identity (100.0% similar) in 83 aa overlap (1-83:1-83)
10 20 30 40 50 60
pF1KE0 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
10 20 30 40 50 60
70 80
pF1KE0 SAKMREWFSETFQKVKEKLKIDS
:::::::::::::::::::::::
CCDS12 SAKMREWFSETFQKVKEKLKIDS
70 80
83 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Thu Nov 3 21:37:02 2016 done: Thu Nov 3 21:37:02 2016
Total Scan time: 1.530 Total Display time: -0.020
Function used was FASTA [36.3.4 Apr, 2011]