FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0201, 83 aa 1>>>pF1KE0201 83 - 83 aa - 83 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8712+/-0.000245; mu= 11.2088+/- 0.015 mean_var=59.5241+/-11.672, 0's: 0 Z-trim(121.2): 3 B-trim: 0 in 0/56 Lambda= 0.166237 statistics sampled from 37441 (37444) to 37441 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.439), width: 16 Scan time: 4.410 The best scores are: opt bits E(85289) NP_001636 (OMIM: 107710) apolipoprotein C-I precur ( 83) 515 130.4 3.2e-31 NP_001307994 (OMIM: 107710) apolipoprotein C-I pre ( 83) 515 130.4 3.2e-31 NP_001307995 (OMIM: 107710) apolipoprotein C-I pre ( 83) 515 130.4 3.2e-31 >>NP_001636 (OMIM: 107710) apolipoprotein C-I precursor (83 aa) initn: 515 init1: 515 opt: 515 Z-score: 681.5 bits: 130.4 E(85289): 3.2e-31 Smith-Waterman score: 515; 100.0% identity (100.0% similar) in 83 aa overlap (1-83:1-83) 10 20 30 40 50 60 pF1KE0 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL 10 20 30 40 50 60 70 80 pF1KE0 SAKMREWFSETFQKVKEKLKIDS ::::::::::::::::::::::: NP_001 SAKMREWFSETFQKVKEKLKIDS 70 80 >>NP_001307994 (OMIM: 107710) apolipoprotein C-I precurs (83 aa) initn: 515 init1: 515 opt: 515 Z-score: 681.5 bits: 130.4 E(85289): 3.2e-31 Smith-Waterman score: 515; 100.0% identity (100.0% similar) in 83 aa overlap (1-83:1-83) 10 20 30 40 50 60 pF1KE0 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL 10 20 30 40 50 60 70 80 pF1KE0 SAKMREWFSETFQKVKEKLKIDS ::::::::::::::::::::::: NP_001 SAKMREWFSETFQKVKEKLKIDS 70 80 >>NP_001307995 (OMIM: 107710) apolipoprotein C-I precurs (83 aa) initn: 515 init1: 515 opt: 515 Z-score: 681.5 bits: 130.4 E(85289): 3.2e-31 Smith-Waterman score: 515; 100.0% identity (100.0% similar) in 83 aa overlap (1-83:1-83) 10 20 30 40 50 60 pF1KE0 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL 10 20 30 40 50 60 70 80 pF1KE0 SAKMREWFSETFQKVKEKLKIDS ::::::::::::::::::::::: NP_001 SAKMREWFSETFQKVKEKLKIDS 70 80 83 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 21:37:02 2016 done: Thu Nov 3 21:37:03 2016 Total Scan time: 4.410 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]