FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0212, 61 aa 1>>>pF1KE0212 61 - 61 aa - 61 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.7432+/-0.000298; mu= 5.9813+/- 0.019 mean_var=139.6767+/-27.604, 0's: 0 Z-trim(122.9): 36 B-trim: 259 in 2/50 Lambda= 0.108521 statistics sampled from 41646 (41690) to 41646 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.798), E-opt: 0.2 (0.489), width: 16 Scan time: 2.770 The best scores are: opt bits E(85289) NP_005943 (OMIM: 156359) metallothionein-1X [Homo ( 61) 516 89.9 2.8e-19 NP_783316 (OMIM: 156351) metallothionein-1E [Homo ( 61) 475 83.5 2.4e-17 NP_005944 (OMIM: 156360) metallothionein-2 [Homo s ( 61) 473 83.1 3e-17 NP_005938 (OMIM: 156349) metallothionein-1B [Homo ( 61) 471 82.8 3.7e-17 NP_005942 (OMIM: 156354) metallothionein-1H [Homo ( 61) 470 82.7 4.1e-17 NP_001288196 (OMIM: 156353) metallothionein-1G iso ( 62) 460 81.1 1.2e-16 NP_005937 (OMIM: 156350) metallothionein-1A [Homo ( 61) 459 81.0 1.4e-16 NP_005941 (OMIM: 156353) metallothionein-1G isofor ( 61) 456 80.5 1.9e-16 NP_005940 (OMIM: 156352) metallothionein-1F isofor ( 61) 454 80.2 2.3e-16 NP_789846 (OMIM: 156357) metallothionein-1M [Homo ( 61) 449 79.4 4e-16 NP_116324 (OMIM: 606206) metallothionein-4 [Homo s ( 62) 367 66.6 3e-12 NP_005945 (OMIM: 139255) metallothionein-3 [Homo s ( 68) 357 65.0 9.3e-12 XP_005256013 (OMIM: 156351) PREDICTED: metallothio ( 127) 242 47.4 3.6e-06 NP_001288201 (OMIM: 156352) metallothionein-1F iso ( 44) 233 45.4 4.9e-06 NP_001005922 (OMIM: 148022) keratin-associated pro ( 278) 189 39.5 0.0018 NP_005544 (OMIM: 148021) keratin-associated protei ( 169) 179 37.7 0.004 >>NP_005943 (OMIM: 156359) metallothionein-1X [Homo sapi (61 aa) initn: 516 init1: 516 opt: 516 Z-score: 467.1 bits: 89.9 E(85289): 2.8e-19 Smith-Waterman score: 516; 100.0% identity (100.0% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_005 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_783316 (OMIM: 156351) metallothionein-1E [Homo sapi (61 aa) initn: 475 init1: 475 opt: 475 Z-score: 432.5 bits: 83.5 E(85289): 2.4e-17 Smith-Waterman score: 475; 88.5% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. :::.::::::::::::::::::::::::::::::::::.:::.:.::::: NP_783 MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_783 A >>NP_005944 (OMIM: 156360) metallothionein-2 [Homo sapie (61 aa) initn: 473 init1: 473 opt: 473 Z-score: 430.8 bits: 83.1 E(85289): 3e-17 Smith-Waterman score: 473; 90.2% identity (95.1% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. ::.::::::::::::::::::::::::::::::::::::::.::::::: NP_005 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_005938 (OMIM: 156349) metallothionein-1B [Homo sapi (61 aa) initn: 471 init1: 471 opt: 471 Z-score: 429.1 bits: 82.8 E(85289): 3.7e-17 Smith-Waterman score: 471; 86.9% identity (93.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. ::::::::::::::::::::: ::::::::::::::::.:::.:.:: :: NP_005 MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_005942 (OMIM: 156354) metallothionein-1H [Homo sapi (61 aa) initn: 470 init1: 470 opt: 470 Z-score: 428.2 bits: 82.7 E(85289): 4.1e-17 Smith-Waterman score: 470; 88.5% identity (95.1% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC ::::::: ::::::::::::.:::::::::::::::.:::::::::::::.:.::::: NP_005 MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_001288196 (OMIM: 156353) metallothionein-1G isoform (62 aa) initn: 401 init1: 401 opt: 460 Z-score: 419.7 bits: 81.1 E(85289): 1.2e-16 Smith-Waterman score: 460; 87.1% identity (96.8% similar) in 62 aa overlap (1-61:1-62) 10 20 30 40 50 pF1KE0 MDPNCSCSPVG-SCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC :::::::. .: ::.::.:::::::::::::::::::::::::::::::::::.:.:::: NP_001 MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC 10 20 30 40 50 60 60 pF1KE0 CA :: NP_001 CA >>NP_005937 (OMIM: 156350) metallothionein-1A [Homo sapi (61 aa) initn: 459 init1: 459 opt: 459 Z-score: 418.9 bits: 81.0 E(85289): 1.4e-16 Smith-Waterman score: 459; 85.2% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. :::.:.::::::::::::::::::::::..::::::::::::.:.::::: NP_005 MDPNCSCATGGSCTCTGSCKCKECKCTSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_005941 (OMIM: 156353) metallothionein-1G isoform 1 (61 aa) initn: 456 init1: 456 opt: 456 Z-score: 416.4 bits: 80.5 E(85289): 1.9e-16 Smith-Waterman score: 456; 86.9% identity (95.1% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. ::.::.:::::::::::::::::::::::::::::::::::.:.::::: NP_005 MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE0 A : NP_005 A >>NP_005940 (OMIM: 156352) metallothionein-1F isoform 1 (61 aa) initn: 454 init1: 454 opt: 454 Z-score: 414.7 bits: 80.2 E(85289): 2.3e-16 Smith-Waterman score: 454; 85.0% identity (95.0% similar) in 60 aa overlap (1-60:1-60) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. ::.:::::::::::::::::::::::::::.::::::.:::.:.::::: NP_005 MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KE0 A NP_005 D >>NP_789846 (OMIM: 156357) metallothionein-1M [Homo sapi (61 aa) initn: 449 init1: 449 opt: 449 Z-score: 410.5 bits: 79.4 E(85289): 4e-16 Smith-Waterman score: 449; 83.6% identity (93.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE0 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC :::::::. ::::.:::::::::::::::::::::::::::::.::.:::: ..:::: NP_789 MDPNCSCTTGVSCACTGSCKCKECKCTSCKKSCCSCCPVGCAKCAHGCVCKGTLENCSCC 10 20 30 40 50 60 pF1KE0 A : NP_789 A 61 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 21:06:19 2016 done: Thu Nov 3 21:06:20 2016 Total Scan time: 2.770 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]